You Searched For: NEW PIG CORP


2,843  results were found

SearchResultCount:"2843"

Sort Results

List View Easy View

Rate These Search Results

Supplier: MilliporeSigma
Description: A tripeptide that serves as a component of the [gamma]-glutamyl amino acid transport system. An endogenous antioxidant that provides protection against auto-oxidation.
Supplier: MilliporeSigma
Description: KOD Hot Start Master Mix is a ready-to-use 2X mixture optimized for convenient high-fidelity PCR
Catalog Number: (80600-352)
Supplier: MilliporeSigma
Description: A cell-permeable, photo-stable nitric oxide (NO) fluorescent indicator with a detection limit of ~10 nM.

Catalog Number: (80057-932)
Supplier: MilliporeSigma
Description: White solid. Suitable for use in liposome preparations. Purity: >= 95% by GC. Soluble in CHCl3, hot EtOH, and pyridine. RTECS FZ8400000, CAS 57-88-5, M.W. 386.7. WARNING! May be carcinogenic/teratogenic.

Catalog Number: (80057-686)
Supplier: MilliporeSigma
Description: Non-ionic detergent used for immunoprecipitation and for the solubilization of membrane-bound proteins. Supplied as a 10% (W/W) solution of PROTEIN GRADE® TWEEN® 80 detergent.

Catalog Number: (80017-506)
Supplier: MilliporeSigma
Description: Media is granulated.

Catalog Number: (80050-522)
Supplier: MilliporeSigma
Description: Complement C1q, is a native C1q complement component composed of 18 polypeptide chains consisting of three non-identical A, B, C subunits of 29, 26, and 19 kDa, respectively.

Catalog Number: (80053-892)
Supplier: MilliporeSigma
Description: Human Protein C (from Plasma)


Catalog Number: (80053-858)
Supplier: MilliporeSigma
Description: Fluorogenic proteasome substrate.

Supplier: MilliporeSigma
Description: Pepsin is isolated from procine stomach mucosa. Catalyzes the hydrolysis of aminoacyl-proline to an amino acid and proline. Inhibitors include aliphatic alcohols, pepstatin A and pH >6.0.
Catalog Number: (80054-834)
Supplier: MilliporeSigma
Description: Activates a variety of immune defense mechanisms by interactions with polymorphonuclear leukocytes, T cells, antibody-producing B lymphocytes, fibroblasts, and hematopoietic bone marrow cells. Activity is not species-specific. Induces apoptosis in human blood and bone marrow neutrophils and in endothelial cells. Increases iNOS levels in vascular smooth muscle cells. Involved in pathophysiological processes of several chronic and acute diseases. Stimulates stress activated protein (SAP) kinase. Biological activity: ED50=20–50pg/mL as measured in a cytotoxicity assay with the TNF-[alpha]-susceptible murine L-929 cells line in the presence of Actinomycin D (80055-066).

Catalog Number: (80057-108)
Supplier: MilliporeSigma
Description: Arthrobacter ureafaciens Recombinant α2-3 (from E. coli)

Catalog Number: (80056-536)
Supplier: MilliporeSigma
Description: This antibody was developed against Recombinant Protein corresponding to amino acids: CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL.

Catalog Number: (80110-008)
Supplier: MilliporeSigma
Description: 1gm. p-Nitrophenyl-b-glucoside. 1-O-p-Nitrophenyl-D-glucose. Off-white solid. Chromogenic substrate for beta-glucosidase. Purity:>=95% by enzymatic assay. Contaminants: p-nitrophenol: <=0.1%. CAS 2492-87-7.

Catalog Number: (80503-320)
Supplier: MilliporeSigma
Description: Native pyruvate oxidase from Aerococcus viridans. Catalyzes the oxidation of pyruvate to acetylphosphate, carbon dioxide, and hydrogen peroxide in the presence of phosphate.

Catalog Number: (80059-040)
Supplier: MilliporeSigma
Description: <p>Cathepsin D, Human liver, Cathepsin D, Human liver, CAS 9025-26-7, is a purified native cathepsin D from human liver. Overexpression of cathepsin D in is associated with higher risk of cancer relapse and metastasis.</p>

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
161 - 176 of 2,843
no targeter for Bottom