You Searched For: MilliporeSigma


2,843  results were found

SearchResultCount:"2843"

Sort Results

List View Easy View

Rate These Search Results

Supplier: MilliporeSigma
Description: Potassium dihydrogen phosphate ≥99.0% (by titrimetric analysis) for molecular biology, Calbiochem®
Supplier: MilliporeSigma
Description: A non-specific protease liquefies mucins and digests proteins to free amino acids.
Catalog Number: (80602-592)
Supplier: MilliporeSigma
Description: Potato Phosphatase

Catalog Number: (EM1.00291.0250)
Supplier: MilliporeSigma
Description: 2-Aminoglutaric acid. CAS RN 56-86-0. Formula Weight: 147.13. 99% min. White crystalline powder. For biochemistry. NH4: 0.01% max. Foreign amino acids: 0.3% max. Heavy metals (as Pb): 0.001% max. Melting Point: 205[degree]C. Packaged in a plastic bottle. 250g.

Catalog Number: (80502-396)
Supplier: MilliporeSigma
Description: 25gm. Ethyleneglycol-bis(beta-aminoethyl)-N,N,N',N'-tetraacetic Acid. White solid. Purity: >=98% by complexometry (dry basis). Contaminants: DNases, proteases, RNases: none detected. Heavy metals: <=0.001% (as Pb). RTECS AH3760000, CAS 67-42-5.

Catalog Number: (80058-790)
Supplier: MilliporeSigma
Description: (Trp). White solid. Purity: >= 98% by titration. Soluble in H2O. RTECS YN6130000, CAS 73-22-3, M.W. 204.2. WARNING! May be carcinogenic/teratogenic.

Catalog Number: (80058-712)
Supplier: MilliporeSigma
Description: Taurodeoxycholic acid is a detergent useful for the solubilization of lipids and membrane-bound proteins.

Catalog Number: (80058-588)
Supplier: MilliporeSigma
Description: (Pro). White solid. A nonessential amino acid. Precursor of hydroxyproline in collagen. Purity: >= 98% by TLC. RTECS TW3584000, CAS 147-85-3, M.W. 115.1.

Catalog Number: (80110-008)
Supplier: MilliporeSigma
Description: 1gm. p-Nitrophenyl-b-glucoside. 1-O-p-Nitrophenyl-D-glucose. Off-white solid. Chromogenic substrate for beta-glucosidase. Purity:>=95% by enzymatic assay. Contaminants: p-nitrophenol: <=0.1%. CAS 2492-87-7.

Catalog Number: (80600-990)
Supplier: MilliporeSigma
Description: Octaethylene glycol monododecylether (C12E8) solution 10%

Supplier: MilliporeSigma
Description: Ribonuclease A, Protease-Free is a chromatographically purified, pyrimidine-specific endoribonuclease that acts on single-stranded RNA
Catalog Number: (80057-108)
Supplier: MilliporeSigma
Description: Arthrobacter ureafaciens Recombinant α2-3 (from E. coli)

Catalog Number: (80056-536)
Supplier: MilliporeSigma
Description: This antibody was developed against Recombinant Protein corresponding to amino acids: CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL.

Catalog Number: (80053-892)
Supplier: MilliporeSigma
Description: Human Protein C (from Plasma)


Catalog Number: (80053-858)
Supplier: MilliporeSigma
Description: Fluorogenic proteasome substrate.

Supplier: MilliporeSigma
Description: Pepsin is isolated from procine stomach mucosa. Catalyzes the hydrolysis of aminoacyl-proline to an amino acid and proline. Inhibitors include aliphatic alcohols, pepstatin A and pH >6.0.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
17 - 32 of 2,843
no targeter for Bottom