Print…

You Searched For: MilliporeSigma


2,843  results were found

Refine Results Sort by
SearchResultCount:"2843"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-80503-250

Potassium dihydrogen phosphate ≥99.0% (by titrimetric analysis) for molecular biology, Calbiochem®

Supplier: MilliporeSigma
Description: Potassium dihydrogen phosphate ≥99.0% (by titrimetric analysis) for molecular biology, Calbiochem®

Certificates

Image Unavailable-80602-614

Protease (from Streptomyces griseus)

Supplier: MilliporeSigma
Description: A non-specific protease liquefies mucins and digests proteins to free amino acids.

Certificates

Image Unavailable-80602-592

Potato Phosphatase

Catalog Number: (80602-592)
Supplier: MilliporeSigma
Description: Potato Phosphatase

Certificates


Image Unavailable-EM1.00291.0250

L(+)-Glutamic acid pH 3.0 - 3.5 (8.6 g/l, H₂O, 25 °C) for biochemistry

Catalog Number: (EM1.00291.0250)
Supplier: MilliporeSigma
Description: 2-Aminoglutaric acid. CAS RN 56-86-0. Formula Weight: 147.13. 99% min. White crystalline powder. For biochemistry. NH4: 0.01% max. Foreign amino acids: 0.3% max. Heavy metals (as Pb): 0.001% max. Melting Point: 205[degree]C. Packaged in a plastic bottle. 250g.

Certificates


Image Unavailable-80502-396

EGTA (ethylene glycol bis(2-aminoethyl ether)-N,N,N',N'-tetraacetic acid) ≥98% (by complexometric analysis, on dry substance), Molecular Biology Grade, Calbiochem®

Catalog Number: (80502-396)
Supplier: MilliporeSigma
Description: 25gm. Ethyleneglycol-bis(beta-aminoethyl)-N,N,N',N'-tetraacetic Acid. White solid. Purity: >=98% by complexometry (dry basis). Contaminants: DNases, proteases, RNases: none detected. Heavy metals: <=0.001% (as Pb). RTECS AH3760000, CAS 67-42-5.

SDS Certificates


Image Unavailable-80058-790

L(-)-Tryptophan

Catalog Number: (80058-790)
Supplier: MilliporeSigma
Description: (Trp). White solid. Purity: >= 98% by titration. Soluble in H2O. RTECS YN6130000, CAS 73-22-3, M.W. 204.2. WARNING! May be carcinogenic/teratogenic.

SDS Certificates


Image Unavailable-80058-712

Taurodeoxycholic acid sodium salt ≥95% (by TLC), Calbiochem®, Millipore®

Catalog Number: (80058-712)
Supplier: MilliporeSigma
Description: Taurodeoxycholic acid is a detergent useful for the solubilization of lipids and membrane-bound proteins.

Certificates


Image Unavailable-80058-588

L(-)-Proline ≥98% (by TLC), Calbiochem®, Millipore®

Catalog Number: (80058-588)
Supplier: MilliporeSigma
Description: (Pro). White solid. A nonessential amino acid. Precursor of hydroxyproline in collagen. Purity: >= 98% by TLC. RTECS TW3584000, CAS 147-85-3, M.W. 115.1.

SDS Certificates


Image Unavailable-80110-008

(4-Nitrophenyl)-β-D-glucopyranoside

Catalog Number: (80110-008)
Supplier: MilliporeSigma
Description: 1gm. p-Nitrophenyl-b-glucoside. 1-O-p-Nitrophenyl-D-glucose. Off-white solid. Chromogenic substrate for beta-glucosidase. Purity:>=95% by enzymatic assay. Contaminants: p-nitrophenol: <=0.1%. CAS 2492-87-7.

Certificates


Image Unavailable-80600-990

Octaethylene glycol monododecylether (C12E8) solution 10%

Catalog Number: (80600-990)
Supplier: MilliporeSigma
Description: Octaethylene glycol monododecylether (C12E8) solution 10%

Certificates


Image Unavailable-80602-644

RNase A, Protease-Free, Highly Purified, Bovine Pancreas, MilliporeSigma

Supplier: MilliporeSigma
Description: Ribonuclease A, Protease-Free is a chromatographically purified, pyrimidine-specific endoribonuclease that acts on single-stranded RNA

Certificates

Image Unavailable-80057-108

Arthrobacter ureafaciens Recombinant α2-3 (from E. coli)

Catalog Number: (80057-108)
Supplier: MilliporeSigma
Description: Arthrobacter ureafaciens Recombinant α2-3 (from E. coli)

Certificates


Image Unavailable-80056-536

Anti-SGSH Rabbit Polyclonal Antibody

Catalog Number: (80056-536)
Supplier: MilliporeSigma
Description: This antibody was developed against Recombinant Protein corresponding to amino acids: CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL.

Certificates


Image Unavailable-80053-892

Human Protein C (from Plasma)

Catalog Number: (80053-892)
Supplier: MilliporeSigma
Description: Human Protein C (from Plasma)
Image Unavailable-80053-858

Proteasome Substrate II, Fluorogenic, Calbiochem®

Catalog Number: (80053-858)
Supplier: MilliporeSigma
Description: Fluorogenic proteasome substrate.

Certificates


Image Unavailable-80053-618

Pig Pepsin (from Stomach mucosa)

Supplier: MilliporeSigma
Description: Pepsin is isolated from procine stomach mucosa. Catalyzes the hydrolysis of aminoacyl-proline to an amino acid and proline. Inhibitors include aliphatic alcohols, pepstatin A and pH >6.0.

SDS Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
17 - 32 of 2,843
no targeter for Bottom