Hen Elafin

Supplier: AnaSpec
AS-61641
103006-886EA 496.92 USD
103006-886
Hen Elafin
Proteins and Peptides
This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Order Now

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR