Human;Rat Neuropeptide Y

Supplier: AnaSpec
AS-22464 AS-22465
102996-232EA 323 USD
102996-232 102996-230
Human;Rat Neuropeptide Y
Proteins and Peptides
Neuropeptide Y (NPY) is a 36aa neuropeptide involved in food intake, fat metabolism, stress and pain reduction, and vasodilation
Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
MW:4271.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Order Now

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR