Human Galanin

Supplier: AnaSpec
AS-22431
103003-398EA 423.85 USD
103003-398
Human Galanin
Proteins and Peptides
Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.
Sequence:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
MW:3157.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Order Now

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR