Chicken OVA (241-270)

Supplier: AnaSpec
AS-64525
103008-218EA 381.46 USD
103008-218
Chicken OVA (241-270)
Proteins and Peptides
This peptide is OVA peptide residues 241 to 270. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SMLVLLPDEVSGLEQLESIINFEKLTEWTS
MW: 3421.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Order Now

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR