You Searched For: Anaspec Inc


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103006-230)
Supplier: Anaspec Inc
Description: C-terminal analogue of C3a, agonist of the C3a receptor
Sequence:WWGKKYRASKLGLAR
MW:1820.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (102996-102)
Supplier: Anaspec Inc
Description: A non-sulfated CCK Octapeptide. Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
Sequence: DYMGWMDF-NH2
MW: 1063.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: Anaspec Inc
Description: Rat ANP differs from the human hormone by only one residue at position 12. ANP (1-28) peptide hormone constitutes the first 28 amino acids of the ANP synthesized in the heart of different vertebrates. It plays an important role in the regulation of blood pressure and natriuresis/diuresis. Residues Phe8, Arg14 and the C-terminal sequence of ANP are known to bind to human NPR-A (Natriuretic peptide receptor type A).
Sequence:SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
MW:3062.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103000-570)
Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:KRREILSRRPS-pY-RK
MW:1925.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-438)
Supplier: Anaspec Inc
Description: Cross-linked Allophycocyanin (CL-APC), highly fluorescent stabilized phycobiliprotein, is chemically modified with SMCC. SMCC reacts with the primary amine on CL-APC and introduces maleimide groups to APC. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of APC with proteins. These conjugates are widely used in applications such as flow cytometry, live cell staining, and immunofluorescent staining.


Supplier: Anaspec Inc
Description: 28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator.
Sequence:HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3325.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103009-726)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (45-73) is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.
Sequence:ESPLQTPTEDGSEEPGSETSDAKSTPTAE
MW:2977.97 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-206)
Supplier: Anaspec Inc
Description: This is a C-terminal Lys(Biotin-LC) modified b-Amyloid peptide, residues 1 to 17. 6-aminohexanoate (LC) is used as a spacer.
Sequence: DAEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
Molecular Weight: 2421.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 21 acetylated at Lys-9 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)
MW:2765.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-424)
Supplier: Anaspec Inc
Description: This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. This is synthesized with C(Npys) at the N-terminus for applications requiring specific conjugation reactions and has a fluorophore labeled with FAM having Abs/Em=494/518 nm. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: C(Npys)YGRKKRRQRRR-K(FAM)-NH2
MW: 2302.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103009-504)
Supplier: Anaspec Inc
Description: This is a monomethylated lysine at position 9 of the 1-21 amino acid histone H3 peptide. This form of histone methylation is characterized as being enriched around transcription start sites. This peptide has been used as a control peptide in a TR-FRET assay for identifying inhibitors of histone lysine demethylases.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA
MW:2269.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-080)
Supplier: Anaspec Inc
Description: This is a Pannexin-1 (Panx1) mimetic blocking peptide. Pannexin-1 is a recently identified membrane protein that can form gap junction-like connections allowing intercellular passage of dyes when overexpressed in two adjacent oocytes or mammalian epithelial cell lines. Blockade of pannexin-1 in macrophage endogenously expressing the ATP-gated P2X7 receptor (P2X7R) blocks the initial dye uptake, but not the ionic current, and also blocks processing and release of interleukin-1beta (IL-1beta) in response to P2X7R activation.
Sequence:WRQAAFVDSY
MW:1242.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-426)
Supplier: Anaspec Inc
Description: This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.
Sequence:YCWSQYLCY (Disulfide bridge: 2-8)
MW:1226.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-472)
Supplier: Anaspec Inc
Description: This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.
Sequence:RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13)
MW:2155.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-016)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-4.
Sequence:ART-K(Me1)-QTARKS
MW:1160.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Molecular Weight: 4230.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 1,910
no targeter for Bottom