You Searched For: Anaspec Inc

Catalog Number: (103008-568)

Supplier: Anaspec Inc

Description: This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
MW: 3433 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Description: Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession #CAE84068) corresponding to the extracellular domain of rat MOG along with a 6x His tag was expressed in E. coli. The recombinant rat MOG (R-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant rat MOG is 14.2 kDa.

Catalog Number: (103010-858)

Supplier: Anaspec Inc

Description: Sulforhodamine 101 acid chloride is quite unstable in water, especially at the higher pH required for reaction with aliphatic amines. Protein modification by this reagent is frequently done at low temperature. This reagent reacts with amine compounds such as amino acids, peptides and proteins to give bright red fluorescent conjugates that are extremely stable, and resistant to protease-catalyzed hydrolysis.

Catalog Number: (103006-246)

Supplier: Anaspec Inc

Description: This Melan-A (26-35) analog, Leu substituted for Ala at position 27, shows better HLA-A*0201 binding properties as well as better immunogenicity and antigenicity than the natural Melan-A (26-35), cat # AS-61011.
Sequence:ELAGIGILTV
MW:985.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-194)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 647 amine is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dye.

Catalog Number: (103006-416)

Supplier: Anaspec Inc

Description: This is a biotinylated HIV-derived cell penetrating TAT peptide . This positively charged biotin-peptide has been used in studies to form a colloidal coat over oligonucleotides-saturated nanoparticles such that TAT-coated nanoparticles when loaded with dense SiRNA molecules could efficiently penetrate a wide variety of human embryonic stem cells.
Sequence: Biotin-YGRKKRRQRRR
MW: 1786.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (102996-406)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-364)

Supplier: Anaspec Inc

Description: Bovine ß-Casein, monophosphopeptide (phospho-Serine) can be used for characterization of affinity purified phosphorylated peptides in liquid chromatography and for the analysis or detection of phosphorylated peptides in mass spectrometry.
Sequence:FQ-pS-EEQQQTEDELQDK
MW:2062 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-686)

Supplier: Anaspec Inc

Description: This is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb. It is fluorescent (5-FAM)-labeled, Abs/Em=494/521 nm.
Sequence: 5-FAM-SIINFEKL-NH2
MW: 1320.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4.
Sequence: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 3369.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103005-822)

Supplier: Anaspec Inc

Description: Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (102996-266)

Supplier: Anaspec Inc

Description: PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
MW: 3147.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-962)

Supplier: Anaspec Inc

Description: This peptide sequence is found in residues 1 to 21 of the histone H3K9(Ac) . H3K9(Ac) is highly localized to the 5’ region of transcription start sites in human genes. Localization of H3K9(Ac)  to the transcriptionally active 5’ region of human genes suggests this peptide is essential for transcription initiation and elongation.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA
MW:2296.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Tetramethylrhodamine (TMR) is one of the fluorophores most often used for preparing peptide, protein, nucleotide and nucleic acid conjugates, especially fluorescent antibodies and avidin derivatives used in immunochemistry. TMR dyes have been widely used as acceptors for FAM fluorophores in a variety of FRET studies. The succinimidyl esters of 5-TAMRA, 6-TAMRA or the mixed isomers are the primary labeling reagents.

Supplier: Anaspec Inc

Description: This cyclic peptide is a potent vasodilator. It is more powerful than the linear GRGDSP in changing the vascular tone of arterioles isolated from rat cremaster muscle.
Sequence:GRGDSP, N to C cyclized
MW:569.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This is one of the predominant amyloid peptide structures deposited in human brain of Alzheimer’s disease and Down’s syndrome patients.Sequence: Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4309.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C