Print…

You Searched For: Enzyme Assays

Either measuring substrate consumption or overall production, the enzyme assays are used to monitor enzymatic activity. Provided with the required supplies and reagents for any preferred method, enzyme kinetics and inhibition studies can be successfully completed. While continuous assay sampling methods give activity readings throughout development, discontinuous techniques calculate after the reaction has been stopped. The standardized enzyme assays will provide accurate identification and measurement of the protein molecules present in samples.

Either measuring substrate consumption or overall production, the enzyme assays are used to monitor enzymatic activity. Provided with the required supplies and reagents for any preferred method, enzyme kinetics and inhibition studies can be successfully completed. While continuous assay sampling methods give activity readings throughout development, discontinuous techniques calculate after the reaction has been stopped. The standardized enzyme assays will provide accurate identification and measurement of the protein molecules present in samples.


1,305  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1305"

Rate These Search Results

Product Image-PAV9361

ADP-Glo*Kinase Assay + GSK3 Alpha Kinase Enzyme System

Description: Substrate: GSK3 Substrate (YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE); derived from human muscle glycogen synthase 1 (amino acid 636–661)
Catalog Number: PAV9361
Supplier: Promega Corporation
Product Image-PAV4040

PKCQ KINASE ENZYME SYSTEM

Description: Recombinant full-length human PKC? was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. Protein Kinase C theta (PKC?) is an important component in the intracellular signaling cascade
Catalog Number: PAV4040
Supplier: Promega Corporation
Product Image-PAV3861

Akt2 Kinase Enzyme System Sf9 Insect Cell 10ug

Description: Akt2 Kinase Enzyme Easily Screen and Profile AKT2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Catalog Number: PAV3861
Supplier: Promega Corporation

SDS


Product Image-PAE1960

Dual-Luciferase Reporter Assay System 10-Pack, 1000 assays

Description: Store at -20[degree]C.
Catalog Number: PAE1960
Supplier: Promega Corporation

SDS Certificates


Product Image-PAV4068

IKKA KINASE ENZYME SYSTEM

Description: Full-length recombinant human IKKalpha was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. IKKalpha is a serine/threonine protein kinase that phosphorylates the I-kappa B protein which is an inhibitor of the transcription factor NF-kappa B.
Catalog Number: PAV4068
Supplier: Promega Corporation
Product Image-PAV2841

Enzyme System

Description: PLK1 Kinase Enzyme System, Recombinant full-length human PLK1 was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag, member of the Polo-Like Kinase family, Deregulated expression of human PLK1 is strongly correlated with malignancies, Size: 1 mg
Catalog Number: PAV2841
Supplier: Promega Corporation
Product Image-76481-802

Amplite/trade; Colorimetric Maleimide Quantitation Kit, Maleimides can be directly assayed spectrophotometrically at 302 nm. However, the small extinction coefficient of 620 M-1cm-1 renders this assay insensitive, and the assay is further complicated by the protein absorbance at the same wavelength.

Description: Amplite/trade; Colorimetric Maleimide Quantitation Kit, Maleimides can be directly assayed spectrophotometrically at 302 nm. However, the small extinction coefficient of 620 M-1cm-1 renders this assay insensitive, and the assay is further complicated by the protein absorbance at the same wavelength.
Catalog Number: 76481-802
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-PAV3192

Enzyme System

Description: ITK Kinase Enzyme System, Recombinant human ITK (amino acids 352-end) was expressed by baculovirus in sf9 insect cells using an n-terminal gst tag. ITK member of the TEC family of nonreceptor tyrosine kinases, requires prior activation of Lck, Storage: -70 deg C, Size: 1 mg
Catalog Number: PAV3192
Supplier: Promega Corporation
Product Image-77441-644

REAGENT ACETYLCHOLINESTERASE

Catalog Number: 77441-644
Supplier: BIOASSAY SYSTEMS
Product Image-PAV9681

ADP-Glo*Kinase Assay + PDK1 Kinase Enzyme System

Description: Substrate: PDKtide ([protein fragment, 39 aa]); derived from two human proteins: residues 1–14 are based on AKT1 (307–320) and residues 16–39 are based on PKN2/PRK2 (961–984).
Catalog Number: PAV9681
Supplier: Promega Corporation
Product Image-PAV8011

ADP-Glo*Kinase Assay + PDGFR Alpha Kinase Enzyme System

Description: Substrate: Poly (4:1 Glu, Tyr) Peptide.
Catalog Number: PAV8011
Supplier: Promega Corporation
Image Unavailable-10023-470

Bilirubin-Total

Description: Bilirubin-Total, Pre-Packaged Barcoded Reagent, Method: Diazo, Endpoint, Format: Liquid, Linearity: 30 mg/dL, Expected Values: 0.2-1.0 mg/dl, Storage: 2-8 Degree C, Test/Kit: 4050, Quantitative determination of Direct bilirubin in serum, Size: 9 x 63 ml/9 x 16 ml
Catalog Number: 10023-470
Supplier: HORIBA INSTRUMENTS INCORPORATED
Product Image-75878-076

EnzyChrom* Creatine Kinase Assay Kit 100 tests

Description: EnzyChrom* Creatine Kinase Assay Kit, Sample: Serum, plasma etc, Species: All, Detection Method: OD340nm, Detection Limit: 5 U/L, Feature: Sensitive and accurate, Apps: quantitative determination of creatine kinase activity, Size: 100 tests
Catalog Number: 75878-076
Supplier: BIOASSAY SYSTEMS
Product Image-PAE1483

Luciferase Assay Reagent, 1000 assays

Description: Store E1483 at -70[degree]C. Store other systems at -20[degree]C. The Reporter Lysis Buffer may be stored at room temperature. Firefly luciferase has become a widely used reporter enzyme for studying gene regulation and expression.
Catalog Number: PAE1483
Supplier: Promega Corporation

Certificates


Product Image-PAV4242

SLK KINASE ENZYME SYSTEM

Description: Recombinant full-length human SLK was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. Inhibition of SLK activity by dominant-negative mutant or RNAi leads to unfocused microtubule arrangement indicating it is needed for microtubule organization.
Catalog Number: PAV4242
Supplier: Promega Corporation
Product Image-PAV6456

P70S6Kb Kinase Enzyme System Sf9 Cell 1 mg

Description: P70S6Kb Kinase Enzyme System, Easily Screen and Profile P70S6Kb Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Catalog Number: PAV6456
Supplier: Promega Corporation

SDS


433 - 448 of 1,305